PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.165970.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family NF-YB
Protein Properties Length: 266aa    MW: 29770 Da    PI: 9.798
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.165970.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB178.75.2e-56119213195
           NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                     vreqdrflPian+srimkk+lPan+ki+kdak+tvqecvsefisfvtseasdkcq+ekrktingddllwa+atlGfe+y++plk yl++yre+++
  Cucsa.165970.1 119 VREQDRFLPIANISRIMKKALPANGKIAKDAKDTVQECVSEFISFVTSEASDKCQKEKRKTINGDDLLWAMATLGFEEYIDPLKSYLNRYRECDA 213
                     69******************************************************************************************876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.6E-52116222IPR009072Histone-fold
SuperFamilySSF471139.94E-39122222IPR009072Histone-fold
PfamPF008082.8E-28125189IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.9E-20153171No hitNo description
PROSITE patternPS006850156172IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.9E-20172190No hitNo description
PRINTSPR006151.9E-20191209No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
RQIKSPHKRK NKKYKRKKEF NQSPISPISA STTTSAPNTK ISLFFFLFLF LFLLLLLRYF  60
LFHNHFQFPF LGFPSHSFPL PSLHVVFLLS SPMADPPTSP PGCSHESGGE QSPNTAAAVR  120
EQDRFLPIAN ISRIMKKALP ANGKIAKDAK DTVQECVSEF ISFVTSEASD KCQKEKRKTI  180
NGDDLLWAMA TLGFEEYIDP LKSYLNRYRE CDAKGSSRGG DESAKRDAVG VLPGQNSQQY  240
MQPGSLTYIN TQGQHMIIPS MQNND*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4csr_A2e-44120210494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B2e-44120210494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818961e-165LN681896.1 Cucumis melo genomic scaffold, anchoredscaffold00016.
GenBankLN7132641e-165LN713264.1 Cucumis melo genomic chromosome, chr_10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004143607.11e-126PREDICTED: nuclear transcription factor Y subunit B-1 isoform X2
SwissprotQ8VYK43e-73NFYB8_ARATH; Nuclear transcription factor Y subunit B-8
TrEMBLA0A0A0KRZ71e-126A0A0A0KRZ7_CUCSA; Uncharacterized protein
STRINGVIT_13s0019g03600.t015e-87(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25453382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37060.34e-74nuclear factor Y, subunit B8